SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012332503.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012332503.1.9421
Domain Number 1 Region: 299-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-72
Family SPRY domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-22
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 101-162
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-17
Family B-box zinc-binding domain 0.00013
Further Details:      
 
Weak hits

Sequence:  XP_012332503.1.9421
Domain Number - Region: 145-234
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0209
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012332503.1.9421
Sequence length 488
Comment E3 ubiquitin-protein ligase TRIM39 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPS
ELKRLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDL
AHLAAEVEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNFSNFPRQYFALRK
ILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTS
GRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLH
IKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLT
IRPPTDWE
Download sequence
Identical sequences A0A1U7V4Q4 A0A2K5E5P8 A0A2K5SC13 F7IQT8
ENSCJAP00000038466 XP_008072692.1.4292 XP_008992342.1.60252 XP_008992343.1.60252 XP_012332503.1.9421 XP_012332505.1.9421 XP_012332507.1.9421 XP_017366005.1.71028 XP_017827095.1.60252 XP_017827096.1.60252 XP_021527155.1.9421 XP_021527156.1.9421 ENSCJAP00000038461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]