SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012335623.1.82741 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012335623.1.82741
Domain Number 1 Region: 373-470
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 2.71e-16
Family Cdc48 domain 2-like 0.0021
Further Details:      
 
Domain Number 2 Region: 562-607
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-16
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012335623.1.82741
Sequence length 609
Comment hypothetical protein AK88_02575 [Plasmodium fragile]; AA=GCF_000956335.1; RF=representative genome; TAX=5857; STAX=5857; NAME=Plasmodium fragile; strain=nilgiri; AL=Scaffold; RT=Major
Sequence
MESCTRGESKHMHFLSNVNSKKKLNIVEKKHILEKVHILPIKKKVDNADALYRKLQLLIN
DKCVLYEGFIIAANGEQERITREKNTWKNLKEGETPKEQDLTNDKADPSKNESNTTGKKI
LEKLNSDQEGPCPNEDSLEIAHRKESHSHTQKKNSNEKECKNTPNNNHICVHEKCNKDNV
ANEISPLKECTDYYVVVNCIPSKGILTLDTLIYTDGKYVDNLKKIHLIIIRDKYYKKYEK
KLKKKFFSLKKYILKKGNQIFNEAMSLIPFSFDHLSSKSSAEKGKSNRTLGAKKGDTSTP
HPTTMKKTSLVLEKILVTCLHPYFMKNRTKLFYTGKLLIINNFSFLVVKIDADVNVGFVD
NSTEICLNADTYDPFKNVHIVPLYDTLPTTYNYDIFTDYIKPYIERHYLSLFSIHDTFFY
KGVQFKIMGIDPMNIKSGRGRITCNTFIYTDGAIKPTFFDVISNESINYIQCLPVEYKPY
AVLNILQQLDADSLLRLFPSTNANLQESALNEQRILSHLDKYKYVYKNHTREDGQGGKML
LDVDADEHIDVKNKSANFAYEQCAVCFEYFQNYDKCIKLACLHTYHWKCVKSWFKFNLTC
PCCRRELII
Download sequence
Identical sequences A0A0D9QLB3
XP_012335623.1.82741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]