SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012344568.1.59471 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012344568.1.59471
Domain Number 1 Region: 54-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000602
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number 2 Region: 154-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012344568.1.59471
Sequence length 347
Comment PREDICTED: uncharacterized protein LOC100863535 isoform X2 [Apis florea]; AA=GCF_000184785.2; RF=representative genome; TAX=7463; STAX=7463; NAME=Apis florea; AL=Scaffold; RT=Minor
Sequence
MWLAGGSCAFLLLALTLYQGHVHAKNDNYHISDVCKKNYMRDLYRKIDGAVLQSQLEKDL
DCTITFQTHSILQRFMLRFDHLQLDCNDHLYIYDGAHAVSSYKADLSCQNTKQTVGAIYT
RTNFVTLKYVTDSWGTLSNGFRLVITAVKDPKHTCKDFRCTQNEFCIERDLLCDGVNHCG
DESDEATSTLCANSEASTILGMQTIWFVIGLVFLILSVAGLVTAAVLCFCRQRAATPRHP
HNAHNAQTHPPVSFPYVRIERGKRRAADGHDHVEVGGRAGITGDLRLGPRIGGNRCHDPA
AAGKLAAPCGPQARAQRGPGPPLLPGKVRSHGSDSDISSSQKDEWFV
Download sequence
Identical sequences XP_012344568.1.59471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]