SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012350485.1.59471 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012350485.1.59471
Domain Number 1 Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 2 Region: 82-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000569
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000122
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 119-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012350485.1.59471
Sequence length 149
Comment PREDICTED: protein crumbs-like [Apis florea]; AA=GCF_000184785.2; RF=representative genome; TAX=7463; STAX=7463; NAME=Apis florea; AL=Scaffold; RT=Minor
Sequence
MDFCYLEPCMMHGKCVSRQDRYECHCYARYSGNNCQIDNGPPCSSGPCRNGGTCSEDAKG
DFSCACKPGFTGLHCESQLGVRVCEQSPCRNEGVCLAVTEAEYKCDCQPGWSGKNCEANI
NECSPNPCRHGGVCIDGVNNYTCICERTG
Download sequence
Identical sequences XP_012350485.1.59471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]