SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012352607.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012352607.1.23891
Domain Number 1 Region: 31-238
Classification Level Classification E-value
Superfamily L domain-like 9.64e-35
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 285-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000326
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012352607.1.23891
Sequence length 504
Comment PREDICTED: amphoterin-induced protein 3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MTWLVLLGALLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGMQDVPAELP
AATADLDLSHNALQRLRPGWLAPLFQLRALHLGHNELDALGRGVFANASGLRLLDLSSNA
LRALGRHDLDGLGALEKLLLFNNRLMHLDEHAFHGLRALSHLYLGCNELASFSFDHLHGL
SATHLLTLDLSSNRLGHISVPELAALPAFLKSGLYLHNNPLPCDCRLYHLLQRWHQRGLS
AVRDFAREYVCLAFKVPTSRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYC
NTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLH
HNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWS
GTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYN
PGGLQLKAGSESASSVGSEGPMTT
Download sequence
Identical sequences G1SA89
XP_012352607.1.23891 ENSNLEP00000022431 ENSNLEP00000022431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]