SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012357280.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012357280.1.23891
Domain Number 1 Region: 314-400,827-912
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000652
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 2 Region: 113-157
Classification Level Classification E-value
Superfamily Elafin-like 0.00000222
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 3 Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000405
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 390-475
Classification Level Classification E-value
Superfamily SEA domain 0.0000615
Family SEA domain 0.013
Further Details:      
 
Domain Number 5 Region: 261-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000925
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  XP_012357280.1.23891
Domain Number - Region: 1023-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 925-959
Classification Level Classification E-value
Superfamily SEA domain 0.0101
Family SEA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012357280.1.23891
Sequence length 1451
Comment PREDICTED: uromodulin-like 1 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MLRTSGLALLALVSAVGPSQASGFTEKGLSLLGYQLCSHRVTHTVQKVEAVQMSYMTYVS
CGGWIPWRRCPKTVYRIQYLVVEVPESRNVTDCCEGYEQLGFYCVLPLNQSREFTSRPGV
CPAEGPEPSTSPCSLDTDCPGLEKCCPWSGGRCCVAPAPQAPERDPTGSWYNVTILVKMD
FEELQQVDPRLLNHMRLLHALVTSALQPMASTIHHLHSAPGDAATTVSRLLLGLSRPLPV
ANVSALLGDIAKRVYEVISIQVQDVNECSYKELNACSGRELCANLEGSYQCVCHQEAPAT
SPRNLNLVWEDCPPLSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGVELLRSARTRS
QALAVAGLEPGVLYRVKTSYQGCGADVSTTLTVKTDAQVFEVTIRIVNHNLTEKLLNRSS
MEYQDFSRQLLHEVESSFPPAVSDLYRNGKLRMQIVSLQAGSVVVRLKLTVQDPGFPVGI
STLAPMLQPLLASTVFQIDRQGTRVQDWDECVDTAEHDCSPAAWCINLEGSYTCQCRTAR
DATPSRAGRACEGDLVSPTGGGLSAAAGVTVPALGTGTAALGLENFTLSPSPGHPQGTPA
AGQAWTPEPPPRRGGSSVVGYDRNNTGKGVEQEVASTAPGLGMDQGSPSQVNPSQGSPSQ
GSLRQGSTSQASPSQASPSHTKPSQASPSHANSSQGSPSHVNSSQGSPSQGSPSQASTSQ
ASPSQGSPSHMNTIGVIGTTSSPKAPGSTHSFPPGATDGPLALPGQLQGNSTMEPPSWPS
PTEDPAGHVMWHATRSTRETLLNLTWLRNEDSGPSGSVALPLTPTLTALKTPTCVPVSIG
RIVVSNVTSTGFHLAWEAGLALDSAFQLTLTSTWSPTVVLETWNTSVTLSGLEPGVLHLV
EILAKACGKEGARAHLKVRTAAQKLVGKVRITNVRYSESFRNASSQEYRDFLELFFRTVR
GSLPATLCQHMDAGGVRMEVIGITNGSVVVEFHLLIIADVHVQEVSAAFLTAFQTAPLLE
VIRGDTFIQDYDECERKEDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPG
NETWATSPERPLTTAGTKAAFVQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFL
QQESIPESSLYLSHPSCNVSHSNGTHVLLEAGWSECGTVMQSNVTNTVVRATLRNDLSQE
GIIHHPKILSPIYCAFQNDLLTSSGFTLEWGVYTVIEDLHGAGNFVTEMQLFIGDSPIPQ
NYSVSASDDVKIEVGLYRLKSNLTVVLTECWATPSSNAWDPVTFSFINNSCPVPNTYTNV
IENGNSNKAQFKLRVFSFINNSIVYLHCRLRICMESPGATCKINCNNFRLLQNSETSATH
QMSWGPLIRSEGEPPRAEAGLGAGYVVLIAVAIFVLVAGTATLLIVRYQRMNGRYNFKIQ
SNNFSYQVFYE
Download sequence
Identical sequences ENSNLEP00000017681 XP_012357280.1.23891 ENSNLEP00000017681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]