SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012358547.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012358547.1.23891
Domain Number 1 Region: 32-365
Classification Level Classification E-value
Superfamily L domain-like 3.17e-59
Family Ngr ectodomain-like 0.072
Further Details:      
 
Domain Number 2 Region: 409-500
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-21
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012358547.1.23891
Sequence length 606
Comment PREDICTED: leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETK
ILDLSKNRLKSVNPEEFTSYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLV
PLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE
QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDM
MPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQ
ELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD
CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGM
YVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT
ILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRR
FNMKMI
Download sequence
Identical sequences G1SAV0
ENSNLEP00000022644 XP_003271983.1.23891 XP_003271985.1.23891 XP_003271986.1.23891 XP_012358547.1.23891 ENSNLEP00000022644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]