SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012358634.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012358634.1.23891
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.57e-17
Family Transcriptional factor domain 0.0074
Further Details:      
 
Weak hits

Sequence:  XP_012358634.1.23891
Domain Number - Region: 13-44
Classification Level Classification E-value
Superfamily RING/U-box 0.0117
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012358634.1.23891
Sequence length 126
Comment PREDICTED: DNA-directed RNA polymerase I subunit RPA12 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSVMDLASTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCTRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF
QEKEDS
Download sequence
Identical sequences A0A2K5HQC2 A0A2K6M3L5 A0A2K6QK90 G1QYE5
ENSNLEP00000005966 ENSNLEP00000005966 XP_003272067.1.23891 XP_010366481.1.97406 XP_010366483.1.97406 XP_010366484.1.97406 XP_011800429.1.43180 XP_011800430.1.43180 XP_011800431.1.43180 XP_011800433.1.43180 XP_012358634.1.23891 XP_017718412.1.44346 XP_017718413.1.44346 XP_017718414.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]