SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012360570.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012360570.1.23891
Domain Number 1 Region: 734-909
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-41
Family DBL homology domain (DH-domain) 0.0000923
Further Details:      
 
Domain Number 2 Region: 919-1034
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-34
Family Pleckstrin-homology domain (PH domain) 0.0009
Further Details:      
 
Domain Number 3 Region: 185-331
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000693
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012360570.1.23891
Sequence length 1192
Comment PREDICTED: puratrophin-1 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MERPLENGDESPDSQGHATDWRFAVCSFRDAWEEEEPASQMHVKDPGPPRPPARATQDEE
LQGSPLSRKLQLPPAADESGDAQRGTVESSSVLSEGPGPSGVESLLCPMSSHLSLAQGES
DTPGVGLVGDPGPSRVMPSGLSPGALDSDPVGLGDPLSETSSKLLEAAPSGSGLPKPADC
LLAQDLCWELLASGMATLPGTRDVQGRAVLLLCAHSPAWLQSECSSQELIRLLLYLRSIP
RPEVQALGLTVLVDARICSPSSSLFSGLSQLQEAAPGAVYQVLLVGSTLLKEVPSGLQLE
QLPSQSLLTHIPMAGLPTSLGGGLPYCHQAWLDFRRRLEALLENCQAACALLQGAIESVK
AVPQPMEPGEVGRLLQQTEVLMQQVLDSPRLAWLQCQGGRELTWLKQEVPEVTLSPDYRT
AMDKADKLYDRVDGLLHQLTLQSNQRIQALELVQTLGAREGGLHQIEVWLQQVGWPALEE
PGELSLDMLLQAQGSFRELYQVAQEQVRQGEKFLQPLTGWEAAELGPPGARFLALRAQLT
EFSKALAQRCQRLADAERLFQLFREALTWAEEGQRVLAELEQERPGVVLQQLQLHWTRNP
DLPPAHFRKMWALATGLGSEAIRQECRWAWAWCQDTRLALDQKLEASLKLPLVGSTASLC
VSQVPAAPAHPPLRKAYSFDRNLGQSLSEPARHCHHAATIAACRRPEAGGGTLPQASPTV
PPPGISDPRSPNRLQLVLAEMVATEREYVRALEYTMENYFPELDRPDVPQGLRGQRAHLF
GNLEKLRDFHCHFFLRELEACTRHPPRVAYAFLRHRVQFGMYALYSKNKPRSDALMSSYG
HTFFKNKQQALGDHLDLASYLLKPIQRMGKYALLLQELARACGGPTQELSALQEAQSLVH
FQLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFVVRTGRHKSVRRIFLFEELLLFSKPR
RGPTGVDTFAYKRSFKMADLGLTECCGDSNLRFEIWFRRRKARDTFVLQASSLAIKQAWT
ADISRLLWRQAIHNKEVRMAEMVSMGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRA
SIAVAPFDHVSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPNFPEEAAL
EAEAELGSQPSLTAEDSEVSSQCPSASGSSGSDSSCVSGQALGRGLEDLPYV
Download sequence
Identical sequences G1QX96
ENSNLEP00000005567 XP_012360569.1.23891 XP_012360570.1.23891 XP_012360571.1.23891 ENSNLEP00000005567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]