SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012362217.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012362217.1.23891
Domain Number 1 Region: 23-131
Classification Level Classification E-value
Superfamily Immunoglobulin 3.18e-21
Family V set domains (antibody variable domain-like) 0.00000269
Further Details:      
 
Domain Number 2 Region: 465-562
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000427
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 3 Region: 355-451
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000917
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 
Domain Number 4 Region: 240-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000502
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 5 Region: 138-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000795
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012362217.1.23891
Sequence length 764
Comment PREDICTED: polymeric immunoglobulin receptor [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPSSVNRHTRKYWCRRGA
SGRCVTLISSEGYVSNNYAGRANLTNFPENGTFVVNIAQLSRDDSGLYKCGLGINSRGLS
FDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAPKRKSLYKQIGLSPVLVIDSS
GYVNPSYRGRIRLDIQGTGQLMFSVVINRLRLSDAGQYFCQAGDDSNSNKKNADLQVLKP
EPELVYEDLRGSVTFHCALGLEVANVAKFLCRESSGENCDVVVNTLGKRAPAFEGRILLN
PQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVK
GVAGGSVSVLCPYNPKESKSIKYWCLWEGAQNGRCPLLVESQGRVQEQYEGRLSLLEEPG
NGTFTVILNQLTSQDAGFYWCLTNGDTRWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKV
SCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSEAFVNCDENSRLVSLTLNPVTRADEG
WYWCGVKQGHFYGETAAVYVAVEESKAAGSHDVSLAKADTAPDEKVLDSGAREIENKAIQ
DPRLFAEEKAVADTGDQAGGSRASVDSGSSEEQGGSSRVLVSTLVPLGLVLALGAVAVGV
ARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGASSITQETSLGGKDEFVATTE
STTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDSPQEA
Download sequence
Identical sequences G1QJI5
ENSNLEP00000001079 ENSNLEP00000001079 XP_003273022.1.23891 XP_003273023.1.23891 XP_012362217.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]