SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012363194.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012363194.1.23891
Domain Number 1 Region: 55-852
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.7e-289
Family Motor proteins 1.52e-16
Further Details:      
 
Domain Number 2 Region: 853-978
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.41e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 973-1089
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.72e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1259-1366
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.2e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1077-1168
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000314
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1366-1467
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000256
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 7 Region: 1531-1644
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000105
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 8 Region: 1776-1877
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000506
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012363194.1.23891
Sequence length 1939
Comment PREDICTED: myosin-9 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQYVTDGSRLWQGELERQLLQANPILEAFGNAKTVKND
NSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKT
DLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGYRAGPSCLLRVI
SGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQK
AQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNS
FEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPG
ILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADE
WLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIVGLDQVAGMSETALPGAFKTRKGMF
RTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRI
CRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFF
RAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLR
NWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKL
QLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQ
NIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAE
FTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQ
IAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESE
RASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTH
EAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDS
EHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNMTGLLSQSDSKSSKLTKDF
SALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLH
AQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELD
DLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLAR
ALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEE
LEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERK
QRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREE
ILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEE
KRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQL
ERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKK
LKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDA
TETADAMNREVSSLKNKLR
Download sequence
Identical sequences XP_012363194.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]