SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012363265.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012363265.1.23891
Domain Number 1 Region: 180-300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000612
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  XP_012363265.1.23891
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012363265.1.23891
Sequence length 324
Comment PREDICTED: cysteine-rich with EGF-like domain protein 2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCDSSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHVGYQGPLCTDC
MDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAETPP
CSAAQFCKNANGSYTCEDVDECSLAEKACVRKNENCYNTPGSYVCVCPDGFEETEDACVP
PAEAGEWHGSLHTGCPPLHGGACT
Download sequence
Identical sequences G1QLG6
XP_012363265.1.23891 ENSNLEP00000001781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]