SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012365616.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012365616.1.23891
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 7.59e-47
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 659-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000443
Family SPRY domain 0.064
Further Details:      
 
Domain Number 3 Region: 1938-2009
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000536
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 4 Region: 437-550
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000654
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 3587-3665
Classification Level Classification E-value
Superfamily EF-hand 0.0000131
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 6 Region: 100-185
Classification Level Classification E-value
Superfamily MIR domain 0.0000144
Family MIR domain 0.029
Further Details:      
 
Domain Number 7 Region: 1342-1466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000285
Family SPRY domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012365616.1.23891
Sequence length 4405
Comment PREDICTED: LOW QUALITY PROTEIN: ryanodine receptor 1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLQYGHAILLRHAHSRMYMSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHIDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
AVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRVGTSLGNILPGPV
VSPTACLLWLCLCLCLTLSPLHASTVSRVDGTVDTPPCLRLTHRTWGSQNSLVEMVFLRL
SLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWGEAENGKEG
TAKEGAPGGTPQAGGEVQPVRAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRL
PHDVVPADNRDDPEIILNTTTYYYSVRVFAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRV
VTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTA
NGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQC
PPRLEMQMLMPVSWSRMPNHYLQVETRRAGERLGWAVQCQEPLTMMALHIPEEKRCMDIL
ELSERLDLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGY
YDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVTTS
LRPPHHFSPPCFVAALPAAGATEAPARLSPAIPLEALRDKALRMLGEAVRDGGQHARDPV
GGSVEFQFVPVLKLVSTLLMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGL
LIKAFSMTAAETARRTREFRSPPQEQPCVVSFPGSLQELVSHMVVRWAQEDFVQSPELVR
AMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLGQIRSLLIVQMGPQEENLM
IQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCY
FCRISRQNQRSMFDHLSYLLENSGIGLGENPRAQGLMQGSTPLDVAAASVIDNNELALAL
QEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENA
NVVVRLLIRKPECFGPALRGEGGSGLLAAISLACLCLSGPSSACHSLVPPSFVCPPLVPT
QLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAMP
CLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEY
THEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKVTRPWGPALGVKMKLPNLRIR
GGPISPPPIFPLSSQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAENYHNTWGRKKKQ
ELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDSSSIE
KRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTN
HCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILA
RSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYT
TVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGE
CLARLAAAMPVAFLEPQLNEYNAFSVYTTKSPRGAVLGLPNSVEEMCPDIPVLERLMADI
GGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPPCTAVTSDHLN
SLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFIPTIGRLRKRAGKVV
SEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAQWLTEPNPSAEE
LFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDIQSGGSDQER
TKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFL
HNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYHLDQLGRFI
QGWEDKGSVKGCGEKSGWRVWRTEGQRDGALRVVGGCRRIGGREARRRARPSDVTPLPCR
HRACNMFLESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFS
RTALTEKSKLDEDYLYIAYADIMAKSCHLEEGGENGEGEEEVEVSFEEKEMEKQRLLYQQ
ARLHTRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVG
FFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRF
LQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQG
KRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDS
SQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLK
LKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEE
FANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGAS
RRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQI
AAQISDTAREAATAVAALLWAAVTRAGPAGAGAAAGALSLLWGSLFGGGLVEGAKKVTVT
ELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDAAEGAGDEEEAVHEAGPGGADGA
VAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEL
EPEKADAENGEKEEIPEPPPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLNYLSRN
FYTLRFLALFLAFAINFILLFYKVSDSPPGEEDMEGSAAGDVSGAGSGGGSGWGLGAGEE
AEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELA
RKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIA
ELLGMDLATLEITAHNERKPDPPPGLLTWLMSIDVKYQIWKFGVIFTDNCYLFHMYVGVR
AGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKE
DMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWK
MYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences XP_012365616.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]