SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012365924.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012365924.1.23891
Domain Number 1 Region: 328-603
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-79
Family Mitochondrial carrier 0.0000436
Further Details:      
 
Domain Number 2 Region: 11-157
Classification Level Classification E-value
Superfamily EF-hand 1.56e-19
Family Calbindin D9K 0.074
Further Details:      
 
Domain Number 3 Region: 159-278
Classification Level Classification E-value
Superfamily EF-hand 0.0000000282
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012365924.1.23891
Sequence length 675
Comment PREDICTED: calcium-binding mitochondrial carrier protein Aralar2 isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDFGGVKPVGSEPVPKSRINLPAPNPDHIGGYKLAVATFAGIENKFGLYLPL
FKPSVSTSKAMGGGP
Download sequence
Identical sequences XP_012365924.1.23891 ENSNLEP00000019397 ENSNLEP00000019397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]