SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012367199.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012367199.1.23891
Domain Number 1 Region: 21-145
Classification Level Classification E-value
Superfamily Lysozyme-like 1.98e-39
Family C-type lysozyme 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012367199.1.23891
Sequence length 146
Comment PREDICTED: lysozyme-like protein 4 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTRDGYTGFGLFQIRGSVWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAWPTWSRYCQYSDTLARWLDGCKL
Download sequence
Identical sequences G1R1F8
XP_003256958.1.23891 XP_012367199.1.23891 ENSNLEP00000007030 ENSNLEP00000007030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]