SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012367776.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012367776.1.23891
Domain Number 1 Region: 11-282
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012367776.1.23891
Sequence length 764
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 12 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPFDHSRVK
LTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREF
EMGRKKCERYWPLYGEDPITFAPFKISCEDEQARTDYFIRTLLLEFQNESRRLYQFHYVN
WPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNLLKAGKI
PEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQLYEIHGAQKIADGVNEI
NTENMVSSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPSAFPT
VTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNESTIEQMDKKLERNLSF
EIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCITDKISKPQELSSDLNVSDTSQNSCV
DCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAMPIPDLSEGNSS
DINYQTMKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGA
VTQNKTNISTASATVSAATSTESISTRKVLPMSIARHNIAGTIHSGAEKDVDVSEDSPPP
LPERTPESFVLASEHNTPTRSEWSELQSQERSEQKTSEGLITSENEKCDHPAGGIHYEMC
TECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEWT
Download sequence
Identical sequences XP_012367776.1.23891 ENSNLEP00000011635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]