SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012368022.1.9945 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012368022.1.9945
Domain Number 1 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.68e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 291-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 515-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 123-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.76e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 347-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 570-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 66-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.65e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 616-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000347
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 2-37
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000103
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012368022.1.9945
Sequence length 670
Comment PREDICTED: zinc finger protein 791-like [Octodon degus]; AA=GCF_000260255.1; RF=representative genome; TAX=10160; STAX=10160; NAME=Octodon degus; AL=Scaffold; RT=Major
Sequence
MEEWALLDPSQKELFRDVMWENFRNVTAIGGSWGDQQIEDEDRIFQKNLRSHTGEKLCVC
KQCGKSFQTQRHRQRHERIHTMEKPYVCKQCGKAFRTHSYCLIHERNHSGGKHYVCKQCG
KGFSTLSICKSHERTHSRGRPYVCKQCGKAFTRLNYCKIHERIHTGEKPYVCKHCGKAFR
THSYCQTHESIHTGEKPYICKQCGKAFSTRTYCVRHERTHTGEKPYVCKQCGKAFTTHSY
CQTHEMTHSGEKPYVCKQCGKAFTRHSECKRHERTHTEEKPHVCKHCGKGFMTPSHCKTH
EMTHTGEKPYVCKQCGKAFRTHSYCLIHESTHTGEKPYVCKQCGKAFGTYHTRKTHERTH
SGGKSYVCKQCGKGFSTHSYCKIHERIHTGEKPYVCKYCGKSFSARIYCQRHERTHTGEK
PYVCKQCGKGFSKHSVCKSHERTHTGEKPYVCKQCGKAFARNSHCQEHERTHTGEKRYVC
KYCGKGFSTRIYCQRHEGTHTGEKPYVCKHCGKGFMTPSHCKSHEMTHTGEKPYVCKQCG
KVFSKHSICKSHERTHSGEKPYVCKQCGKAFARNSHCQEHERTHTGEKHYVCKYCGKGFS
THIYCQRHERAHTGDKPYVCKHCGKGFMTPSHCKTHEMTHSKEKPYVCKQCGKAFRTQSY
CRTHERTHTG
Download sequence
Identical sequences XP_012368022.1.9945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]