SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012371983.1.9945 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012371983.1.9945
Domain Number 1 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 94-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.77e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-20
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-18
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 10 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000493
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 11 Region: 61-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000106
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 12 Region: 2-37
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000785
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012371983.1.9945
Sequence length 647
Comment PREDICTED: zinc finger protein 709-like [Octodon degus]; AA=GCF_000260255.1; RF=representative genome; TAX=10160; STAX=10160; NAME=Octodon degus; AL=Scaffold; RT=Major
Sequence
MEEWALLDPSQKKLYRDVMWETFRNVADLGRNLGSKKIEDEYKNFRRNLRAHIVKNAYIS
KYDGKFFGDSTSFDNHQKTHSGEKPYLCKHCGKAFSTHSDCQRHERTHTGEKPYDCKQCG
KAFRTHSDCQRHERTHTGEKPYECKQCGKAFRTHSDCQRHERTHTGEKPYECKQCGKAFS
THSDCQRHERTHTGEKLYECKQCGKAFSTHSNCRIHERIHTGEKPYVCKQCGKAFSRHSN
CQIHERTHTGEKPYVCKQCGKGFSRHGTCRIHERTHTGEKPYVCKQCGKGFSRHSHCQIH
ESTHVGEKPNECKQCGKVFSTQSDCLRHERTHSEEKLYVCKQCGKSFRTHSDCQRHERTH
TGEKPYVCKQCGKAFSRHGNCQMHERTHTGEKPYVCKQCGKAFSRHGACQIHERTHTGEK
PYVCKQCGKAFSRHSHCQIHERTHIGEKPYECKQCGKAFSTHSDCQRHERTHTGEKLYVC
KQCGKAFSTLSSCRTHERTHTGVKPHVCKQCGKAFSTRSHCRIHERIHTGERPFVCKQCG
KAFSTHSNCQVHERTHTGEKPYVCKQCGKAFSTPGCCRKHERTHSRVKPYVCKQCGKAFT
TQRYCRIHERIHTGHKSFECKQCGKTFITQRGCQEHERKHWKETLSI
Download sequence
Identical sequences XP_012371983.1.9945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]