SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012375516.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012375516.1.11602
Domain Number 1 Region: 824-1005
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 2 Region: 980-1101
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 3 Region: 185-215,308-437
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 25-179
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  XP_012375516.1.11602
Domain Number - Region: 432-494
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0549
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012375516.1.11602
Sequence length 1231
Comment PREDICTED: TBC1 domain family member 4 isoform X4 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
METPSCIQDEPFPHPLEPEAGPGKPGEKRFRLWYVGGSCLDRRTTLPMLPWLMAEIRRRS
QKPEAGGCGAPPAREVLLVLSAPFLRCVPAPGAGGTGGTSPAAAQPNPAVFIFEHKAQHI
SRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKAAMKEDA
KPNKDNEDAFYNSQKFEVLYCGKVTVSHKKAPSSLIDDCIKKFSLHEQLRLKIQGEQCRP
APDDDLLVFEAEGPASPGDSPVEEMDGITSPHSVLPAVASHPGPPSSRVCFPERILEDYG
LDEQQEFRSRCSSVTGVMQRKVHESSQKTQPRRRHASAPSHVQPSDSEKNRTMLFQVGRF
EINLISPDTKSVVLEKNFKDISSCSQGIKHIDHFGFICRESPEAGLSQYTCYVFQCASES
LVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVIQRHL
SSLTDNEQADIFERVQKMKPVNDQEENELVILHLRQLCEAKQRTHIHTGEGPSTISNSTI
PENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLASEKDC
SPGDTPPGTPPASPLSPAWQTFPEEDSDSLQFRRRAHTFSHPPSSSKRKLNLQDGRAPGV
RSPLLRQSSSEQCSDGEGRKRTSSTCSNESLNVGGTPVTPRRVSWRQRIFLRVASPMNKS
PSAMQPQDGLDRNELLPLSPLAPNKEEEPLVIFLSGDDDPERVEERKKSEELRSLWRKAI
HQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGVCQKEVLITWDKKLLNCRAKIRCD
MEDVYASLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDTSYKELLKQLTAQQHSIL
VDLGRTFPTHPYFSVQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQA
FEMLKFLMYDLGFRKQYRPDMMPLQIQIYQLSRLLHDYHRDLYNHLEENEISPSLYAAPW
FLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECENFENIVEFLKST
LPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLKDELQESSYAYEDSEPVEKLERANS
QLKRQNMDLLEKLQVAHAKIQTLESNLENLLTRETKMKSLIRTLEQEKMAYQKTVEQIRK
LLPADALASCEVLLRDLNCNPNNKAKTGNKP
Download sequence
Identical sequences ENSDNOP00000022652 XP_012375516.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]