SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012379999.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012379999.1.11602
Domain Number 1 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 582-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.68e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 414-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 22-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-20
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 6 Region: 302-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.76e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000101
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 628-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000276
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 544-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000278
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 461-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000522
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 103-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000055
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 178-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000293
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012379999.1.11602
Sequence length 665
Comment PREDICTED: zinc finger protein 304 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MCEWIDRGPWERCLMLAHLSLSWQGGMTFEDVFVYFSREEWGLLHEAQRCLYRDVMLENF
ALVASLSCWRKAEEDEVPSEQDVSVEGVSLVRTPESGQFIQETHPYKMCDPVLKDILHLA
EHQGSLPMQKPYTCEPCGRDFSFSKNFYQQQKQHSTENSFRENDGMVSFVKGCTVYLSGR
PFTCREEGRDFLDSSGFFQHQTTDNGVSPYERTEYREAFPHSFNLGQHQGDAGQMLFKYS
DYGEAFLKTFAFLGSQIAHSEVRPFRCLICGNAFKEKSALINHRRTHSGERSHVCKDCGK
DFIHLSHLRMHQKFHPRKRFYTCGECGKAFSRKDTLVQHQRIHTGERSFDCNECGKAYSR
SSHLVQHQRIHTGERPYKCGECGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHL
IEHWRIHTGARPYECIECGKFFSHNSSLIKHRRVHTGSRSYVCSKCGKAFSCKDTLVQHQ
IIHTGARPYECRECGKAFSRKDTLVQHQKIHTGERPYECGECGKFFSHSSNLIVHQRIHT
GAKPYECSECGKCFSHNSSLILHQRVHSGARPYVCNECGKAYISSSHLVQHKKVHTGARP
YECSECGKFFSRNSSLILHQRVHTGEKPYICNECGKAYSRNSHLLRHMKVHTGERPNECN
NFVTL
Download sequence
Identical sequences XP_012379999.1.11602 ENSDNOP00000034783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]