SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012386168.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012386168.1.11602
Domain Number 1 Region: 93-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 149-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 9-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-19
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 7 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 57-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 10 Region: 364-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000243
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 196-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000388
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 12 Region: 280-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000418
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012386168.1.11602
Sequence length 580
Comment PREDICTED: zinc finger protein 709-like [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MPAKVLAMQSHELVTFKDVAVDFTKEEWDLLDTTQRKLFREVMLENISNLVSVEKLKEYH
LCGKTFIQSSSLKKHERTHTGEKPHECHLCGKAFTLVSNLKRHERTHTGEKPYECLLCGK
AFSRHSHLQRHERTHTGEKPHECHLCGKAFFHLSVLKQHERTHTGEKPHKYLLCGKAFSH
CSSLQQHERTHTGGKPYECHLCRKTYSHYNSFKCHERTHTGEKPHECHLCGKAFFRLYAL
KRHERTHTGEKPHKCLLCGKAFSHRCSLRRHERTHTGGKPYECHLCRKTYSHYNSFKCHE
RTHTGEKPHECHLCGKAFFHLSALKRHERTHTGEKPHECHLCGKAFFHLSALKQHKRTHT
GEKPHKCLLCGKAFIHCSSLQCHERTHTGEKPHKCHLCGKAFFHLSALKRHERTHTGEKP
HECHLCGKAFFHLSALKQHERTHTGEKPHKCLLCGKAFSHCSSLQRHERTHTRGKPYECH
LCRKTYSHYNSFKCHERTHTGEKPHECHLCGKAFKTYSHYNSFKCHERTHTGEKPHECHL
CGKVFFHLSALKQHEITHTGEKPHECHLFGKAFIQLSNLK
Download sequence
Identical sequences XP_012386168.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]