SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012395946.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012395946.1.9362
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 29-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.17e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 113-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 12 Region: 641-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012395946.1.9362
Sequence length 703
Comment PREDICTED: zinc finger protein 420-like, partial [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MRLLCPPGSRLRGVPEEEAMAPGVIARVGQESVTFKDVAVEFTLEEWIHLNTSQKKLYRD
VMLENYKNLVSLGFAVSKPEVIYRMERKEASWMPETHIPRSNGSERKKFTGEKPFECKEC
GKAFYFNSECNRHQRIHTGEKPYKCNECGKAFRLTVQLNVHKRIHTREKHYECNECGKSL
SSNTSLKAHKKIHTGEMPYECKECGKAFRQRIQLIQHQTIHTGEKPYKCDECGKILSSNT
SLKAHKKIHTGEMPYECKECGKAFRQRIQLIQHKTIHTGEKPYKCDECGKILSSSTSLKA
HKKIHTGEMPYECKECGKAFYFNSERNRHQRIHTGEKPYKCNECGKAFRLTVQLTRHKRI
HTGEKPYECNECGKAFLRNSDFMRHQSIHTGEKPYECNECWKAFCHIAELTQHKRIHTGE
KPYKCKECGRTFRLKTQLTQHQRIHTGEKPYKCDECGKAFRLGKQFIQHQRIHTGEKPYE
CDHCGEAFRLRPQLTQHQKFHHGEKPFVCNDCGKGFFGKSDFIRHQSIHTGEKRYECNEC
GKAFRLRTQLIQHQRIHTGEKPYKCDKCGKAFRVKKQFNHHQRIHTGEKPYECENCGETF
RLKPQLIQHQVIHTGEKPFVCDECGKSFFWNSDFMQHQSIHTGEKPYKCDKCGKTFRLKK
QFSHHQRIHTGEKPYECNYCGETFRLKPQLNQHQRIHIGFTPF
Download sequence
Identical sequences XP_012395946.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]