SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012397283.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012397283.1.9362
Domain Number 1 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000222
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 904-956
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000442
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 740-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000777
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 399-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000238
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 961-1010
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000141
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 871-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000231
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 778-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000731
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012397283.1.9362
Sequence length 1198
Comment PREDICTED: zinc finger protein ZFAT [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MCKFCNLFSPSQSELLSHASAKHKEEGVNIDDIIIPLRPLTTTESTNQHKSGEELLVVKR
KRGRPKGSTKKLCPDEESTENTNCSLNEENQLASPEGNSLPEVPEVVPSNLECSKCCRKF
SNTRQLRKHICIIVLNIEEEGEPGNDSEVELDRKEKEDEREKVPKRSRTQKAEKVQKISS
GKETVQLSGAKKPIISVVLTAHEAIPGATKIVPVEAGPPETETDNSKATIPDLAHRRGYQ
EYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSHCS
YASAIKANLNVHLRKHTGEKFSCDYCVFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSD
VKNLIKHIRDTHDLQDKKVKDAFDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLV
HGDEWPFACELCGHGATKYQALELHVRKHPFVYVCSVCLKKFVSSIRLRSHIQEVHAALQ
EAVVFNDSINQSFCLLEPGGDIQQEAVGDQLPPAGGELEFQAEGPQKEATSPEETSKENE
GRSISHVELSAAASLDLEIPQGVANVTVPSSELATEVATPELHSQVVSEDFLLKNNTSDP
AETQAPSKNDLQDQPGNSANTIQGEEITLLLPRDKNSEPNQENTSTENPVAEGENIVALS
LTELEARKSPKTNPAQATEPSSAATSSDSRVSTQPDSSTTLPSEHQTRTAAFMQVLNNLQ
KRQMNTSMCEKIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCNYSSITKN
CLKRHVIQKHSNILLKCPTEGCDYSTPDKYKLQAHLKVHTELDKRSYSCPVCQKSFSEDR
LIKSHIKTNHPEVSMSTISEILGRRVQLKGLIGKRAVKCPYCDFYFMKNGSDLQRHIWAH
EGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADG
KQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPNEDYV
NVGTGELAADALIQQEISESLDCPTGSGGPGCRSEQEPPQGVPRLLEGIPEGSVPPLGIP
VPGHGGPRSSSASDRAAFNLLCVVTHTSGWPLEHRNQSKVTEEEQSTNHTVMIQETLQQA
SVELAEQHHLVVSADDVEGIETVTVYTQGGEASEFIVYVQEALQPVEEQTIEHPAQDI
Download sequence
Identical sequences XP_012397283.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]