SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012397681.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012397681.1.9362
Domain Number 1 Region: 430-540
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000108
Family PWWP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012397681.1.9362
Sequence length 753
Comment PREDICTED: PWWP domain-containing protein MUM1 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MMDTQYVLCRWKKRLWPAKVLPQTGLSTRKHIQKMRSAFLNVEILSLDKKIKVKKTETKI
LEKSQIEEIAAELTTQVEIKTTPKEELIYRRSLKFGLDVLSQKADAIEANSLSKSLTTPV
LHKLKQTRPAHAVSESDSSPFVCEEVVGGSGPFKKENVLQRLSSSPIEENKCKKGLKRSV
RIYGNKTEPLASPARNIFGTQKLQHQKSEIPKSWSRTGKNQKQKKDDSSQNLQLNLKKKL
EIKDSGKKGRKRPRISNRYSSPFNAREEDDTNTELGELSPVLSSSNSIHLMALEKKTSSS
SRKALDFSTNRSFVESECENELGKVPSLKYCKVLNGIKQSSVSECHCLEPEEIGLCTNGS
DTPPGVSNCSLVCPNYFAPKTRTLKLPDFEDDEEELQSSEQSLEFSSVNTTVVDEEEEDE
ELPSILSRPEPCSIEAGMLVWCKYQKYPYWPSVVKSVKRKDKKASILYIEGNMNPEKRGF
TVSLRRLKHFDCEEKQELMDKAKEDYSQGVDWCIMLISDYRIRIGCGSFVGSFLEYYSAD
ISCPVRKVIQQAPIKTVFPILNKEEPEDGLSDTSLNKKQSFKKVLPDRRRAARDKANEKL
VEYIVNEKGAENHLLAILKSRKKSRWLKEFLNSSQYMTCVETYLEDDEQLYLVVKYLQEV
YQEIDSKMLTLINGDGIKFILDVLLPEAIIYAISAIDEIDYQTAEKKYIEGPSVSKRERE
MFDKELLEEKKKELTLLKTETSFPEMSPDVSKL
Download sequence
Identical sequences G3WLW9
ENSSHAP00000016424 XP_012397680.1.9362 XP_012397681.1.9362 XP_012397682.1.9362 XP_012397683.1.9362 ENSSHAP00000016424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]