SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012398857.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012398857.1.9362
Domain Number 1 Region: 56-517
Classification Level Classification E-value
Superfamily Sema domain 4.05e-119
Family Sema domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1685-1812,2000-2186
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1150-1245
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000686
Family Other IPT/TIG domains 0.0087
Further Details:      
 
Domain Number 4 Region: 1242-1334
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000672
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 520-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000558
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1331-1376,1410-1463
Classification Level Classification E-value
Superfamily E set domains 0.0000000000315
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012398857.1.9362
Sequence length 2219
Comment PREDICTED: plexin-B1 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MCSFSSPGDLIHTGHAAVCLLCLLYQVTMLILGSALLQLLWAVCAPASAMQQSPLVSFTP
NNTRLQHLVRDPISGTLYLGATNFLFQLSPELTLEATVPTGPVLDSRDCLPPVLPLECPQ
AQLTDNPNQLLLVSPSGSGQDEGALVVCGSAHQGVCEQRRLDHIGQLLLRPERPGDTQYV
AANDPAISTVGLVGQGPAGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEET
AKLAVGRLSEYSHHFVAAFARRTSVYFLFLRRDLQAQSRAFRPYLSRVCLSDQHYYSYVE
LPLSCGGAPYGLVQAAAVAVPGKGSQEEGGEVLFAAFSSVSPSTMGRAPAAGVSGASALC
AFPLDEVDQLANRTRDACYTRDGRAEDGTEIAYIEYDVNSNCAQLPVDTLDAYPCGSDHT
PSPMASRVPLEATPLVEWTDVQLTAVAVSVEDGHTIAFLGDSQGQLHKVYLGPEGDHRPY
ATQLIQSGSAVSSDLIFDWALEHLYVMTQSTVVRVPVASCSQHLDCTSCLAPKDPYCGWC
VLLGRCTRRAECSRGRGPEPWLWSFSPEPKCLEIQAVSPANVSREEKRNIFLSISDLPVL
RPDESYSCYFEEYKSPAVRTDAGVMCPSPDPSRTPALQMGADHVSVPLWLKFGEVVIAST
KFSFYDCAAAATLHPSTPCRACVQSSWGCSWCVWQHLCTHKTACEGGPVVHSQRRPLSAS
WPLLSSVAPTGNGPTFLPSVPPRAPVTPAPKLPPTEPGPLLVESASPSPDPMPPPTEQAP
RTPPPEPGPPPTIPMLTTVAPPTTETFTPSTAGPEVTPGPETAPPEEPSRLPSIPLDPGT
VEGVGDTATVVEAPGAVTEAEALVPPAPSPSPLGGQPSDTAALTSSSWELGSLAPSSSPR
WGPAPSLGPSTTFPGVAGSEGHAPDWLLREDELPEADEWTGSDSSPFSTSTLLSGDGDSS
EFEGPNAPRILLPDLDYQYDSPGLWELEEAVNQGPAACPCVEGIEGSPLLPVQIERELTL
LGRNFHLYQDGLGDYECVLEVEGHMEVTTARVECDGVTGTLCRIICQLHQLSYAALQPEF
HVPVFLRKSGRLRVDSTEGLHVTLYDCSVGRPDCSLCRTADPRYSCVWCDGSHPHCVARE
ACAEAEAALCPAPLIHMVEPLTGPVDGGTRITIRGSNLGQKHQDIAETVTVAGVPCAVDA
LEYEVSSSIVCVTGGSGEEKVGHVTVEVPGGGHGISDHKFAYQDPEVKSIFPVRGPKAGG
TYLTLQGSKLLTGRLEDIRVLVGDHPCQLFPVAQMEQLQCQTSPSPVAAALQVAVWFGGV
ERQLQQGLFQYTPDPNITSAGPAKSFVSGGRVIWVHGQNLDVVQTPRIRVTISTEEQKQR
QRRGLGRRRRIIPETETECSQGTPCSTQHFEEPCHINSSHLLVCRTPAIPGLPGGTWVQL
EFVLDNLLFDFATLHPTRFSYEANPILRPLNLEDPSSPFRHKPGSVLSVEGENLDLAISK
DEVVAMIGDGPCLVKTLTRNHLYCEPPAEQPLPRHREGLNSLPEFTVQMGNLNFTLGRVQ
YDIESPLAFPVGAQVGLGVGASLLALGVLIIVFIYRRKSKQALRDYKKVQIQLENLETSV
RDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDYKSYAERVFFPGHRESPLHRDLGVPESRR
PTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDIL
RTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKH
QVDKGPVDSVTGKAKYTLNDNRLLREDLEYRPLTLNAVTVPGVGLAEAPGVPVKVLDCDT
ISQAKEKILDQLYKGVPLAQRPDPSALDVEWRSGVAGHLILSDEDVTSVVQGAWRRLNTL
QHYKVPDGATVALVPRFSKHIPRENQDYVPGEKTPMLEDMDEGGIRPWHLVKPSEEPEPP
RQRRGSLRGGDRERAKAIPEIYLTRLLSMKGTLQTFVDDLFQVILSTSRPVPLAIKYFFD
LLDDQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTF
MDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISASDQEMNSALAELSR
NYSGDLSALVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences XP_012398857.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]