SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012406716.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012406716.1.9362
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-42
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 2 Region: 929-1079
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-39
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1216-1355
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-38
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 4 Region: 633-778
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-37
Family C-type lectin domain 0.00000345
Further Details:      
 
Domain Number 5 Region: 786-922
Classification Level Classification E-value
Superfamily C-type lectin-like 8.93e-36
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 6 Region: 496-637
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-32
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 7 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.07e-32
Family Cysteine rich domain 0.00000146
Further Details:      
 
Domain Number 8 Region: 1084-1211
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-31
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 9 Region: 230-343
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-28
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-19
Family Fibronectin type II module 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012406716.1.9362
Sequence length 1450
Comment PREDICTED: macrophage mannose receptor 1 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MKVSLFLVFLSLTCGASQLLDTKQFLIYNDDHKRCVNVISSSAVQTAVCNPESESQKFRW
VSNTQLMSISLKLCLGVSSKTDWVQVTLFPCDSKSDLQKWECKNDTLFGILGEDLYFNYG
NKQEKNIMLYKGSGLWSRWKIHGTSDDLCSRGYEEIYTLLGNSNGAPCVFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYEVTRLFGFCPRKFAGSESLWTKDPLTGISYQINSKSALTW
HQARKSCQQQQSELLSITEVSEQTYLTGLTNSLTTGLWIGLNSLSFNSGWQWAGYSPFRY
LNWLPGSPALEPGKSCVLLNPAKNAKWENVECSQKLGYICKKGNSSLNQFIIPSESDVPI
SCPSQWWPYAGHCYKISREPKIQKDAKTTCRKEGGDLASIHSIEEFDFIFSQLGYEDTDT
LWIGLNDLKHQMFFEWSDDTPVTFTKWLPGEPSHANNRQEDCVVMKGKNGYWADHPCEGH
HGYVCKSKPLSTPPVVEVDTGCKKGWKRHGPYCYMIGQTLSTFEVANHTCINQNAYLVTV
EDRYEQAFLTSLVGLRPEKYFWIGLSDVQNKGTFKWTIDENVQFSHWNSLMPGRKTGCVA
MKTGIAGGLWDVLKCEEKAKFVCKHWAEGVTPPPIPTTTPAPKCPDGWISSSKTNLCFKV
FGKSKYSKKTWFDARDFCRAIGGDLARITNKEDQSTIWQNIGTSNYHDVFWLGLTIANTD
EGFTWSDGSPVTYENWSYGEPNNYGNIEFCGELKADPSMRWNDINCELLRKWICHIKKGD
ELKPEPTPSPESNPPVTEDGWVIYKDYQYYFSKEKSTMENARAFCKKNFGDIVTISGESE
KKFLWKYISALDLEATYFIGLLISLDKKFSWMDGSKVDYVAWAPGEPNFANDDENCVVLY
TSSGLWNDINCGFPNAFICQRHNSSINTTASPTPLPPLGGCRWGWKLFQNKCYKIFGAKE
EERKNWQAARKDCQGYGGNLVSIHSRKEQAFLTTELLESTYDSWIGMNDINSENKFLWTD
GRGVQYTNWAKGFPAGRRSFLSYEDVDCVVIVGGPSLEAGKWIDEICENEKGYICQTDSD
PAQPHPSTPTSGNFIRFGDSSYSVVTSKMKWKDAKEYCEGSSSQIASILDPYVNSFVWLE
MQKHNEPMWIGLNSNLTQGEYAWIDRWRMRYTNWGPGEPQVKSGCVYMDLEGFWKTAPCN
ESYQFLCKKSDVSPATEPPQLPGRCPDSEQSSWIPFSGHCYYIESSSTRSWGQALLECSR
MGASLVSIESAVESTFLTYKVEPLKSKTNFWIGMFKNVEGNWLWIDNTAVSFVNWKTGEP
SNDRNEDCVELYSSSGFWNNLYCSSYKGYICKREKIIDAKATEAIKPNDGPETRKAPKSH
NSAGIIVVVVLLILTGVGAAAYFFYKKRQVQIPQEGNFDNTLYFNTGSISGVSDTKDLMG
NIEQNEHALI
Download sequence
Identical sequences G3WGQ2
ENSSHAP00000014607 XP_012406716.1.9362 ENSSHAP00000014607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]