SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012407789.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012407789.1.9362
Domain Number 1 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-25
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 99-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.79e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-24
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 548-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-21
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 9-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 11 Region: 57-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 12 Region: 591-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012407789.1.9362
Sequence length 665
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 260-like [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MGPGSLGPPREVVTFKDVAVDFTQEEWGLLDPSQKELFKEVMVENVQNLLSLEGKIHTGE
KPCECNHCGKVFRSKKGLTDHQRIHTGEKTYEYNQCGKAFRRKGNLTVHQQTHTGEKPYE
CNQCGKAFRSKGNLIVHHQTHTGEKPYECNQCGKAFRDKRTLIVHERIHTGEKPYECNQC
GKTFRDKKVVTRHQKIHTGEKPYECNHCEKAFRSKGHLTRHQIMHTGEKPCECNQCGKAF
RDKSALTIHERIHTGEKPYKCNQCGKAFRKKRALTVHERIHTGEKPYQCNQCGKAFRDKS
TLTVHERIHTGEKPYEYNQCGKAFRKKGNLTVHQQTHTREKPYECNQCGKAFRSKGNLIV
HQQTHTGEKPYECNQCEKAFRDKKTLIVHQRIHTGEKPYECNHCGKAFRDKRYLIVHERI
HTGEKPYECNHCEKAFRRKGHLTKHQIMHTIEKPYECNQCGKAFIDKTALTVHERIHTGE
KPYECNQCGKAFRKKGNLIIHQRIHTGEKPYECNQCGKAFTQKGTLTAHQSTHTGEKPYE
CNQCGRGFRRKANLIVHQQTHTEEKPYECNQXGKSFGSKGKLTRHQVIHTGEKPYEYNQC
GKAFRHKSSLTDPESTCTYEKSYDCNQCWKAFANRGFFTRYQRTQTGQKPQCKQCGKAFG
GNLGC
Download sequence
Identical sequences XP_012407789.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]