SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012431663.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012431663.1.42559
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-21
Family YWTD domain 0.00046
Further Details:      
 
Weak hits

Sequence:  XP_012431663.1.42559
Domain Number - Region: 145-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012431663.1.42559
Sequence length 179
Comment PREDICTED: low-density lipoprotein receptor-related protein 1B-like, partial [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
KLFFTDYGNAAKVERCDMDGTNRTWIVDSKIEQPTALALDLINKYVYWLDIYLETVEVVD
YQGRRRQTITKGRQIRHLSGLAVFENYLYTINSDNLSILRIDRYNGTDVQALARLDNAKE
IRVYQKRTQAAARSHACEPDPSGTPGGCSHICLLGSSHKARTCRCRTGFILATDGRSCK
Download sequence
Identical sequences H0ZV04
59729.ENSTGUP00000014451 ENSTGUP00000014451 ENSTGUP00000014451 XP_012431663.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]