SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012435701.1.20347 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012435701.1.20347
Domain Number 1 Region: 26-207
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.27e-70
Family Inorganic pyrophosphatase 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012435701.1.20347
Sequence length 212
Comment PREDICTED: soluble inorganic pyrophosphatase 1 isoform X2 [Gossypium raimondii]; AA=GCF_000327365.1; RF=representative genome; TAX=29730; STAX=29730; NAME=Gossypium raimondii; AL=Chromosome; RT=Major
Sequence
MAEGEANANETSRQAPKLNERILSSLSRRSVAAHPWHDLEIGPDAPNVFNCVVEIAKGSK
VKYELDKKTGMIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDCLVIMQEPVVPGCFVRA
RALGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELPPHRLTEIKRFFEDYKKNENKEV
AVNDILPSSTAFEAIQHSMDLYGEYLLQTLSK
Download sequence
Identical sequences A0A0D2SZT5 A0A1U8NF75
XP_012435701.1.20347 XP_016737647.1.88148 XP_017636664.1.75545 Gorai.008G132200.1|PACid:26816677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]