SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012446368.1.20347 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_012446368.1.20347
Domain Number - Region: 239-277
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0235
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012446368.1.20347
Sequence length 423
Comment PREDICTED: uncharacterized protein LOC105769935 isoform X2 [Gossypium raimondii]; AA=GCF_000327365.1; RF=representative genome; TAX=29730; STAX=29730; NAME=Gossypium raimondii; AL=Chromosome; RT=Major
Sequence
MSPSGDGAINGGCCCSCSPGENGGYDGATNFGISASHDETCMHCPRSEPSSCSSSELGFD
PVLLTDSERLRRIFVASAKGFSIGAGLQGGLAIFSILARLRRKKPKKVEAFSDKEAISMA
IKETLRYGIFLGTFAGTFVYVDETVAACGGNHRTAKWRALVAGLVAGPSMLLTGSNTRHT
SLAIYILMQAAVLASRCGIKSKRFGKFCKPLTWKHGDIFLMCLSTSEILSSYILKQDCLP
PSYKSFLNQHGGKDIVILQGVKELASDLPFTTLEAIEKIYKATGVDVKLDPNMKIPCSMV
HGNKSCRAHAITFLIEAYKRALPVYLPVYLIPALIVHHQGLFKRPCTILGKGIVDIARSS
LFLATYCTSAWMWTCMLFGFLRRCSIPLIAIGSVKDSFNLSYLEYPCSTYIQTSMTRQIH
SKA
Download sequence
Identical sequences A0A0D2S755
Gorai.009G237000.2|PACid:26762731 XP_012446368.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]