SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012467748.1.20347 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012467748.1.20347
Domain Number 1 Region: 52-282
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.2e-85
Family Inorganic pyrophosphatase 0.000000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012467748.1.20347
Sequence length 286
Comment PREDICTED: soluble inorganic pyrophosphatase 6, chloroplastic-like [Gossypium raimondii]; AA=GCF_000327365.1; RF=representative genome; TAX=29730; STAX=29730; NAME=Gossypium raimondii; AL=Chromosome; RT=Major
Sequence
MAPTTVAAPSSCMLLKTPFSLKRGSKALSLNNGRRLSKRLFSCNAIYNPQVRIKREGQPE
TLNYRVFFEDASGKKISPWHDVPLHLGNGVFNFIVEIPKESSAKMEVATVELYTPIKQDT
KKGKLRYYPYNINWNYGLLPQTWEDPSFANSEVEGAFGDNDPVDVVEIGDSRGKIGEILK
VKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVNDVEKHFPGTLTAIRNWFRDYKIPD
GKPANKFGLGNKAASKEYALKVIKETNESWAKLVKRSIPAGDLSLV
Download sequence
Identical sequences A0A0D2QGP6
Gorai.002G211300.1|PACid:26795970 XP_012467748.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]