SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012493257.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012493257.1.63892
Domain Number 1 Region: 265-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-64
Family Eukaryotic proteases 0.00000014
Further Details:      
 
Domain Number 2 Region: 83-199
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-25
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 226-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000535
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012493257.1.63892
Sequence length 523
Comment PREDICTED: complement C1r subcomponent-like protein [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MALVPDVQFQMPGPRMGELPLEKPSLRRLPRQASSQSAGELEPSLRVVGFSDRSQETSSQ
WWLLLWGVLQVCPTQGSVLLAQRLSQQLTSPRYPEPYLKGQDSTVDIEAPEGFAVRLVFQ
DFDLEPSEDCERDSVTISASGTDLSRFCGQQGSPLGSPPGQREFVSSGRSLRLTFHTRSS
SEDKTTHLHRGFLALYQAVAVSCRQPTSRASVGSEAISTPGDSPAEIHNHCQEPYYQAVT
AGTLTCTAPRTWKDREGREEVPQCAPVCGQPVIPIAQNQTTLGSSRAKLGNFPWQAFTSI
YGRGGGALLGDRWILTAAHTIYPKDSVSLRKKLSVDVFLGHTDINEMLKLGNYPVHRVVV
HPDYRQNESHNFNADIALLELQHSVPLGPSVLPVCLPDNETLYLSGLQGYVSGFGVEKGW
LTTKLKYSRLPVAPREACEAWLQRKQRTEVFSDNMFCVGDEMQENNACQGDSGSVYVVWD
DRAHHWVATGIVSWGVGCNTGYGFYTKVLNYMDWIKGVMDGRD
Download sequence
Identical sequences XP_012493257.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]