SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012510624.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012510624.1.63892
Domain Number 1 Region: 59-555
Classification Level Classification E-value
Superfamily Sema domain 6.54e-99
Family Sema domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1419-1544,1710-1867
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 896-988
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000117
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 987-1077
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000525
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.082
Further Details:      
 
Domain Number 5 Region: 1074-1157
Classification Level Classification E-value
Superfamily E set domains 0.00000000000327
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 558-610
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000785
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012510624.1.63892
Sequence length 1934
Comment PREDICTED: plexin-D1 isoform X1 [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPRSARAATTSPLPPRPPFRTPPRPPVPTRCLLPLLLLLLGTAPVGALEIQR
RFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQ
ASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAE
PVTVFPSMLNVAANHPNASTVGLVLPPASGAGGSRLLVGATYTGYGSAYFPRNRSLEDHR
FENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPAAPPP
GAPSYAYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGR
GDLYSRLVSVFPAGELLFAVFERPQVAPGVRAAPAALCAFRFTDVRAAIRAARTACFVEP
APDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGL
TSVAVAVANNYTAVFLGTVNGRLLKINLDESMQVVSRRVVTVAYGEPVHHVMQFDPADPG
YLYLMTSHQMARVKVAACNVYSTCGDCVGAADAYCGWCTLETRCTLQQDCANSSQQHFWT
SASEGPGRCPSMTVLPAEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPG
PAFGHQIAYCNLLPRDQFPPFPPHQDHVTVEMSVRVNGRNIVRTNFTIYDCSRMGQVYPH
TACTSCLSAQWPCFWCTQQHTCVSNWSLCEASPNPTSPRDCPQTLPSPLAPVSTGGSQDI
LVPLANAAYFQGAALECSFGLEEIFEAVWVNESVVRCNQVVLHTARKSQVFPLSLQLKGW
PARFLDSPDPMTVVVYNCAMGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPQPGTCPAP
EIRAIEPLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEPLANRYMVSEQIVCAT
GPAPGPFSDVVTVNASKEGRSRERFSYVLPLVHSLEPAVGPKAGGTRITILGSDLHVGSE
LQVLVNDTEPCTELVRTDSSITCTMPGGTLPAAVPVCVRFERRGCVRGNLTFWYMQNPVI
TAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALS
NASAPVDFFINGRAYTDEVAVAEELLEPEEAQRGSGFRLDYLPNPQFSTAKREKWIKHHP
GEPLTLVIHKEQDGLGLQTHEYRVKIGQVACDIQIVSDRVIHCSVNESLGAAEGQLPITI
QVGNFNQTIATLQLGGSETAIIMSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQM
EEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERY
VLPSQTLNSQGSSPVQETHPLLGEWKIPESRRPNMEEGISLFSSLLNNKHFLIVFVHALE
QQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVE
KMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQISKGSIDAITGKARYTLNEEWLLRENI
EAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRVEDVDLEWF
ASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLSRVKDLDTE
KYFHLVLPTDELAEPRKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRED
KPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHI
DACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMAPLSEQ
EMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVV
ALMEDNIYECYSEA
Download sequence
Identical sequences XP_012510624.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]