SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012517419.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012517419.1.63892
Domain Number 1 Region: 74-499
Classification Level Classification E-value
Superfamily Sema domain 1.05e-98
Family Sema domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1396-1522,1717-1868
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-39
Family p120GAP domain-like 0.041
Further Details:      
 
Domain Number 3 Region: 951-1039
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000049
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 859-954
Classification Level Classification E-value
Superfamily E set domains 0.00000000000035
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 502-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000288
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1038-1083,1121-1174
Classification Level Classification E-value
Superfamily E set domains 0.0000000128
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012517419.1.63892
Sequence length 1936
Comment PREDICTED: plexin-B3 [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MVAHQDNAPTAISCPSPLPLGSRTEEMCHTAWDTPLLHPFMAPAMAPGPPFGLQLLLLLL
LLAPPPLPLTGAHRFSAPNTTFNHLALAPSQGTLYVGAVNRLFQLSPELQLQAVAVTGPV
IDSPDCVPSRDPAECPQAQLTDNANQLLLVSGQAQELVACGQVRQGVCEKRRLGNVAEVL
YQAEDPGDGQFVAANAPGVATVGLVVPLPSRDLLLVARGLAGKLSAGVPPLTVRRLAGPQ
PFSSEGLGRLVVADFSDYNNSYVGAFADARSAYFVFRRRGARAQAEYHSYVARVCLGDAN
LYSYVEVPIACRGQGLIQAAFLAPGTLLGAFAAGPRGVQAALCAFPLAELDRSMERARRL
CYTAGGRGPSGTEEATVEYGVTSRCVTLPLDSPGAYPCGDEHTPSPIAGRQPLEAQPLLQ
LEQHVSAVAALQADGHTIAFLGDAKGQLHKVFLNGSQGQVYHSQQVGPPGSAISPDLLVD
SGGSHLYVLTAQQVDRVTVAACPQFPDCTSCLQAQDPLCGWCVLQGRCTRKGQCGRAGQP
NQWLWSYEDSHCLYIQNLLPAHRPRQEQGQVTLSVPQLPTLAVDEYFHCAFGDYESLAHV
EGPHVSCVTPPQDQVPLNPPGTDHVTVPLALMFENVAVAAANFSFYDCSAVQALEVAAPC
RACVGSLWRCHWCPQSSHCVYGDHCPEDERTVYSAQEVDVQVRGPGACPQVEGLASPHLV
PVGWESRLALHVRNLQHFRGRPASYLCWLELPGERWRLPATLEETAADTGVIHCQAQQFR
TSVSQQELRVPVYVTRGEAQRLDDAHALHVTLYDCAVGHPDCSHCQAANGSLGCLWCSDD
QPACRYGPLCAPAAVQLLCPMPSIDVIEPLTGPPEGGLAVTILGSNLGRAFADVRDAVSV
AGRPCSPDPDLYRTSARIVCVTSPAPSGTTGPVQVAIKSRPPGISSQHFTYQDPVLLSLS
PRWGPQAGGTQLTIHGQHLQTGGNVSAFVGGQPCPIQEPVCPEAIVCRTMPQAAPGEAVV
LVVFGHAQRTLLASPFHYTVNPQLVAAEPSTSFRGGGRLIRVRGTGLNVVQRPLLSVWLE
AVEEVQASGTQPQGPNPRRSCGASAVDTQACIQLGGGLLQCSTVCSVNSSSLLLCQSPAV
PNGARPQRVFFALDNMHVDFTSASGGQRFLYQPNPRLAPLSREGPGRPYRLKPGHVLDVE
GEGLTLGSSKEEVRAHIGTGECLVKTLTLTHLYCQPPPRAPPPAGPDALPQFVVQMGHVR
LALGPVQYEAEPTPPAFPAEAQAGLAGGAAVLVAAVLLLTLVYRHKSEQALRDYQKVLVQ
LESLETGVGDQCRKEFTDLMTEMTDLSSDLESSGIPFLDYHAYAERAFFPGHGGCPLQPK
PEGPGEEGCRATVRQGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALH
GKLEYLTDIMKTLLGDLAAHYVHKNPKLMLRRTETMVEKLLSNWLSICLYAFLREVAGEP
LYMLFRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFRPLTLMVLVGPGAGGATGGS
EAQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDL
TSVTQNHWKRLNTLQHYKVPDGATVGLIPQPHDGSTVSQSQAHSHPSGENIPMLEDGEEG
GVRLWHLVKATEEPEGAKVRRSSLRERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQA
ILSVNRPVPIAVKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFWVNALKNPQLIFDM
RVSDNVDAILTVIAQTFIDSCTVSEHKVGRDSPVNKLLYAREIPRYKQMVEKYYVDIRQS
SPTSYQEMNSALAELSGNYTCAPHCLEALQGLYNHIHRYYDQIISALEDEPLGQKVQLAC
RLQHVAALVENKVTDL
Download sequence
Identical sequences XP_012517419.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]