SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012521137.1.63892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012521137.1.63892
Domain Number 1 Region: 2203-2296
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 507-645
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-29
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1467-1515,1593-1707
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-27
Family FAS1 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1708-1862
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-25
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 963-1119
Classification Level Classification E-value
Superfamily FAS1 domain 6.54e-22
Family FAS1 domain 0.0065
Further Details:      
 
Domain Number 6 Region: 386-497
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-20
Family FAS1 domain 0.0063
Further Details:      
 
Domain Number 7 Region: 2294-2456
Classification Level Classification E-value
Superfamily FAS1 domain 8.76e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1127-1247
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000314
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 9 Region: 1539-1576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000801
Family Merozoite surface protein 1 (MSP-1) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012521137.1.63892
Sequence length 2566
Comment PREDICTED: stabilin-1 isoform X2 [Propithecus coquereli]; AA=GCF_000956105.1; RF=representative genome; TAX=379532; STAX=379532; NAME=Propithecus coquereli; AL=Scaffold; RT=Major
Sequence
MVGPRGLLLLCLLAFCLADFSFVRGQKVRSKRCDTTTKYVTHVPCTSCVVIKKRACPVGW
LRELPEKISQDCRYEVQLGDSVVSMMGCSRECWKDVVQKACCPGYWGSQCHECPGGAETP
CNGHGTCLDGMASNGTCVCQENFSGSACQECRDPNRFGPDCQSACSCVHGVCSHGPLGDG
SCLCFAGYTGPRCDQELPACQALRCPQNSQCSAEAPACRCLPGHTQQGSECRAPDPCQPS
PCSPLARCSVSPKGQAQCHCPENYHGDGMVCLPQDPCTVNFGGCPSNSTLCLYHKPGKAS
CTCRPGLVSTNRGTSAGCFAFCSPHSCDKSATCQLTPSGKTSCVCKEGEVGDGRACYGHL
LHEVQKAGQIGLVPLLLRAAVAMLDQGCREILTTSGPFTVLVPSFLSSRTMNASLAQQLC
RQHIIAGQHILEDIGTQKTRRWWTLAGQEITVTFSSFTKYTYKYGDQPQQTFNIQRANYV
AANGVFHLVTGLRWQPPSGTSGDPTRTIGQILASNEAFSRFETILENCGLPSILDGPGPF
TVFAPSNEAVDGLRDGRLIYLFTAGLSKLQELVRYHIYSHGQLTVEKLISKGRVLTMANQ
VLAVNISEEGRILLGPEGLPLRRVDVQAANGVIHMLEGVLLPPTILPILPKHCSEEQHKI
VPGSCVDCQALNTSTCPPNSVRLDLYPKECVYIHDPTGLNVLKKGCASYCNQTVTKLGCC
KGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGVCLCFPDYKGIACHICSNPNKHGDLCQ
EDCGCVHGLCDNRPGSGGVCQHGTCVPGFTGRFCNETVGDCGPTGLAQHCHLHARCVSQG
GVARCLCLDGFEGDGFSCTPSNPCSHPNRGGCSENAECVPGPLGTYHCTCHKGWSGDGRI
CVAIDECELAGRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRAGNGGCHGL
ATCRAVGGGQRVCTCPPGFGGDGFSCYGDISRELESNAQFSGFYQWFKSAGITLPTDGRV
TALVPSEAAIRRLSPEDQAFWLQPRVLPNLVRAHFLQGALCEEELARLGGQDVATLSPTT
RWEIHNISGRVWVQNASVDVADLLATNGVLHILSQVLLPSRGDVQCGLLQQLALVPAFSL
FRELLQRHRLVSQIEAATAYTIFVPTNRSLEGNSSSLDADTVRHHVVLGEALSVEALRRG
GHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLEAPGCSLFGLSGVMTVGSSRCLHSHA
EALREKCVNCTRKFRCTQGFQLQDTPKKSCLYRSGFSFSRGCSYTCAKKIQVPDCCPGFF
GTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGVCDC
AHGLCQEGLRGDGSCVCNVGWQGLRCDQKITGPQCPKKCDPNANCVQDSAGAPTCVCAAG
YSGNGTHCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEVNSCLIHR
GGCHIHAECIPTGPQQVSCICREGYRGDGIRTCELLDPCSQSNGGCSPYAVCKSTGDGQR
TCTCDTAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELRGDGPFTVFVPHADLMT
NLSQDELARIRAHRQLAFRYHVVGCRQLRSQELLDQEYATALSGHTLRFSEREGSIYIND
FARVVSSDHEAVNGVLHFIDRVLLPPDALHWEPDATLVPRRNVTAAAQSFGYKIVSDLLS
VAGLLPLLRDAAHRPLTMLWPTDSALRALPPDRQAWLYHEDHRDKLAAILRGHVIRNVEV
LASDLPNLGPLRTMHGTPISFSCSRARPGELMVGEDDARIVQRHLPFEGGLAYGIDQLLE
PPGLGARCDRFETRPLQLKTCSICGLEPPCPEGSQEQGSPEACWRYFSKFWMSPSLHSLA
LRSIWAQPSLWVQPQGRGRGCRRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCSNHGVC
LDGMSGSGQCRCRSGFAGTACELCAPGAFGPSCQACHCASHGHCDEGLGGSGSCFCDEGW
TGPRCEVQLELQPVCAPPCAPQAMCREGNSCECSLGYEGDGRMCTVADLCQDGHGGCSER
ANCSQVGTVVTCTCLPDYEGDGWSCRARNPCADGHRGGCSEHADCLSTGPNTRRCECHAG
YVGDGLQCLEELEPPVDRCLGQPPPCHMDAMCTDLHFQEKRAGVFHLQATSGPYGLNFSE
AEAACGAQGAVLASLPQLSAAQQLGFHLCLVGWLANGSAAHPVVFPAAHCGNGQVGIVSL
GARKNLSEHWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVLAATANFSTFYGMLLGY
ANATQRGLDFLDFLDDELTYKTLFVPVNEGFLDNMTLSGPDLELHASNTTFLSANASQGK
LLPAHSGLSLAVRDMGPDNSSWAPVAPGAVVVSHVIVWDIMAFNGIIHALASPLLTPPQP
RAVLAPEAPPVAAGVGAVVAAGTLLGLVAGALYLRARGKPAGFGFSTFQAEDDADDDFSP
WQEGTSPTLVSVPNPIFGSHDAFCEPFDDALLEEDFPDTQRILTVK
Download sequence
Identical sequences A0A2K6ET48
XP_012521137.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]