SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012523392.1.53737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012523392.1.53737
Domain Number 1 Region: 97-549
Classification Level Classification E-value
Superfamily Sema domain 2.88e-123
Family Sema domain 0.0000539
Further Details:      
 
Domain Number 2 Region: 1436-1560,1817-2001
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 900-990
Classification Level Classification E-value
Superfamily E set domains 0.000000000000021
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 1079-1150
Classification Level Classification E-value
Superfamily E set domains 0.000000000000602
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 551-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000327
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 993-1079
Classification Level Classification E-value
Superfamily E set domains 0.000000000616
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012523392.1.53737
Sequence length 2037
Comment PREDICTED: plexin-B [Monomorium pharaonis]; AA=GCF_000980195.1; RF=representative genome; TAX=307658; STAX=307658; NAME=Monomorium pharaonis; AL=Scaffold; RT=Major
Sequence
MRFLGLTQSFPKSPTVTPLQVPLSPPLLHRLSFSSMSIATWFLVILATAAIDTPASTILP
IQDNKSPHIVAQFPVENGQQYGHFSLDANATREGALRFNHLTIDPSSGRLYGGAINRLFQ
LDSNLKLEEYVSTGPRLDNPQCHATGCNSREIATSLMDNVNKLLIADLESQMLIACGSLL
QGACEKYKMSNISIKPEFIPLSVAANDENSSTYAFIGPEKYNPWGQTNILYVGTTFTNKG
DYRHDVPAISSRNLDKLDFAEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQ
KQSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHHYNLVQDAKVAAA
GSDLAMQLGISVGDPVFISVFSPSRGITNEPLPRSAVCIYSLQDIETKFNENIHMCFNGS
IKYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFITSIS
IANTESHTVAFFGTNDGVLKKVLLSGVEAFVYESVTIDKGQKLLPDTLISPEGKYIYVLS
NSKISKVKVEHCNGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTG
QQCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCP
TPPVAERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSW
CVYDNKCTHNTSCQGIISGENQNPANLAAHGAQYCPRFMERKEPLMLPNSVPKEIVLEVE
NLPHPQVGHSGFQCIVSIEGANLKVQARVDSSRFIVCDKTVYSYEAVSGEYEAEVTVVWN
TNHHVDKTTIILYKCEVLGSHREHADCSLCVTRDTRFECTWCGNSCVYRHSCLQSPFTEC
PKPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLVDYEVSVRIVCR
TGRHEATDAASVVVGNDAGYTESAVLFNYKDIRLSGVYPSVGPQSGGTQLAITGKYLNIG
STISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRVHRLTLSIDGANRTLMNNPYNYTH
DPTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQME
CPSPSVAKRFILIRRSERSTTTTAQGTSSPHSLRLKESQLSLKIAFIMDNVESVRDLEKQ
SLRNRLLYVEDPKFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLA
LTQLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAI
AGIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTD
MTDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNVSRTNYDAAMIQFEQL
VNNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVN
TKHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITH
DARYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTP
FSLRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQ
NDGFSVACKPPCHNCKPSHYHPQQQPPSIHPHHQPSHQHHLHRHSNHCSSTHLPSTPNHG
LISPVMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDVHYPPGLGFT
GSSKHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLD
EAAKQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDS
CSMTEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHA
NEFDVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences XP_012523392.1.53737 XP_012523393.1.53737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]