SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012587536.1.23501 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012587536.1.23501
Domain Number 1 Region: 115-611
Classification Level Classification E-value
Superfamily Sema domain 1.28e-100
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1480-1605,1778-1934
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.39e-33
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 953-1045
Classification Level Classification E-value
Superfamily E set domains 0.000000000000187
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 1136-1216
Classification Level Classification E-value
Superfamily E set domains 0.0000000000268
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 5 Region: 1044-1137
Classification Level Classification E-value
Superfamily E set domains 0.0000000000455
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Domain Number 6 Region: 614-665
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000379
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012587536.1.23501
Sequence length 2002
Comment PREDICTED: plexin-D1 [Condylura cristata]; AA=GCF_000260355.1; RF=representative genome; TAX=143302; STAX=143302; NAME=Condylura cristata; AL=Scaffold; RT=Major
Sequence
MAPQETTGACLVLEAPPAPPTAQGVPPPVFCLILEPVSRATCKAPLVGLRGCAGLGVPRP
GSLREGCGWGPLGRTGVRKAEQERGVEERDDGVRGKRQPGRGERGTGSRERGAQTRRFPS
PTPTNNFVLDGAAGTVYLAAVNRLYQLSGANLSLEAEADVGPVADSPLCHAPQLPQASCE
HPRRLTDNYNKILQLDPDQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTV
FPSMLNVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENT
PEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPPPGAAS
YAYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLY
SRLVSVFPTRELLFAVFERPQGAPAARSAPAALCAFRFADVHAAIRAARTACFVDPAPDV
VAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLSSVA
VASVSNYTVVFLGTASGRLLKINLDESMQVVSRRVVTVAYGEPVHPVMQFDPADPSYLYL
MTSHQMARVRVAACAVHSTCGDCVGAADAYCGWCTLETRCALQRDCANSSQPHFWTSASE
GPGRCPTMSVLPAEIDVHQEYPGMILQISGSLPSLSDMEMTCDYGNSTRTVARVPGPAVG
HHQMAYCNLLPRDQFPPFPPHQDHVTVDMAVRVNGRNIVGATFTIYDCSRTGEVYPHTAC
TSCLSARWPCFWCTQQHACVSNQSRCEASPNPTSPRDCPQTLPAPLAPVPTGGAQSILVP
VANAAAFQGAALECSFGLEESFEAVWVNESAVRCSQVVLHTTQESQAFPLSLQLKGQPAR
FLDSPDPVTVEVYNCAVGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPLPGSCPAPEIR
MIEPLSGPLEGGTLLTIRGRNLGRRFSDVAQGVWIGSVACEPLADRYTVSEEIVCATGPA
PGVFADVVTVNASTEGKSRERFSYVLPLVHSLEPAVGPKAGGTRITVHGSELHVGSELQV
LVNDTEPCTELVRTEASIACTVPGGALPASVPASVPVCVRFEHRGCVGGNLTFWYMRNPV
ITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHRIGREPTLCKVLNATLITCPSPGAL
SNASAPVEFFINGRAYADELAAAEELLDSEEAQRSSRFRLDYLPDPQFSTAKREKWIKHH
PGEPLTLVIHKEQDSLELESHEYRVKIGQVACDIQIVSDRVIHCSVNESLGTAEGQLPIT
VQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQ
MEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSVYEEC
YVLPPQTVNSQGSSPVQETHPLLGEWKVPESCRPNMEEGISLFSSLLNNKHFLIVFVHAL
EQQKDFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVV
EKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLREN
IEAKPRNLNVSFQGCGMDSLSVRAVDTDTLTQVKEKVLEAFCKNVPYSQWPRAEDVDLGQ
HPLPTRCPPFPIPLHLSHSLGVFLDRPPFFLSHPPHEFPRVPPSLCPLLSPLIYLLCFPL
AVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFK
AILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVF
DIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIH
DMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAAIYKYAKRYRRQIMAALEANPTAQRTQL
QHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_012587536.1.23501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]