SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012598453.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012598453.1.48125
Domain Number 1 Region: 196-317
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.1e-49
Family Anticodon-binding domain of Class II aaRS 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012598453.1.48125
Sequence length 579
Comment nuclear receptor coactivator 5 isoform X1 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDHRDSRDIRDHRDSRSMRDARDMRDLRDFRDLRDSRDFRDHRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESHSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPDEGVRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGPISRQSLGATSGASLKTQPSPQPLQSGQVLPSATPT
PAAPPTSQQELQAKILSLFNSGTVAANSSSASPSVVTGSTQNQNFSTAANSQPQQRSQAS
GNQPPNILGQAGSARNMGPRPGAPSEGLFGQPSSRLAPPSNMASQRPVSSISINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQVGQPQAPMGSYQRHY
Download sequence
Identical sequences XP_012598453.1.48125 ENSMICP00000010366 ENSMICP00000010366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]