SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012606113.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012606113.1.48125
Domain Number 1 Region: 26-253
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-45
Family Nuclear receptor ligand-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012606113.1.48125
Sequence length 256
Comment nuclear receptor subfamily 0 group B member 2 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MSSSQPGPCPCRGAVGRPAILYELLSPSLRPVPLPRSHCLCRQHRPVRLCTPHRTCREAL
DVLAKTVAFLRNLPSFCQLPPQDQRRLLQGGWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGSSGQPDRPQPSLAEVQWLQCCLESFWSLELGPKEYAYLKGTILFNPDVPG
LHTSSHIGHLQQEAHWALCEVLEPWSSAGQGRLARVLLTASTLKSIPPSLLGDLFFRPII
GEVDIAGLLEHMLLLR
Download sequence
Identical sequences XP_012606113.1.48125 ENSMICP00000014263 ENSMICP00000014263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]