SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012614025.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012614025.1.48125
Domain Number 1 Region: 162-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.44e-46
Family Nucleotide and nucleoside kinases 0.0000000146
Further Details:      
 
Domain Number 2 Region: 27-161
Classification Level Classification E-value
Superfamily SH3-domain 3.21e-34
Family SH3-domain 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012614025.1.48125
Sequence length 471
Comment voltage-dependent L-type calcium channel subunit beta-3 isoform X4 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MEGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYCGV
LDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQ
KARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVT
DMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSE
IERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMK
HLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRATHHPAPGPGLLGPP
SAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAY
QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHNDRNWQRNRPWPKDSY
Download sequence
Identical sequences A0A2I3SCI4 A0A2J8SYU8 A0A2K5CSA0 A0A2K6GR24 G3QJN9 M3YTH6
ENSMPUP00000014636 ENSMPUP00000014636 XP_003793636.1.62490 XP_003825858.1.60992 XP_004400937.1.74151 XP_004778966.1.14098 XP_006729326.1.47382 XP_012508768.1.63892 XP_012614025.1.48125 XP_016779004.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]