SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012614295.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012614295.1.48125
Domain Number 1 Region: 145-207
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 838-894
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 725-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 782-838
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 879-931
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 339-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000107
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 688-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000124
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012614295.1.48125
Sequence length 1006
Comment zinc finger protein 316 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MAALHTMPDSPTTQLERIEDGSECDADQEEEEEEERGEEEEEEIVVEEEEEVEDVAQVEE
VAEVEVGAEEEEEDDDDVEEVLAEEQSPALGTQEQLSPGGDAKSPVLQEKALQASGLPAT
PGDEDLEEEEEEEEEDDDEDDFLTAGSQGLVTFEDVAVYFSLEEWERLDTDQRGLYQEVM
EENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDDMEDH
EEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGLDPGSLGIL
ADGSEAKPFLPSREPGANLLSAWAFPATVAALAGRPETTCDVCGKVFPHRSRLAKHQRYH
AAVKPFGCDECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIHTGER
PYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCPHCGRSFSQSSALARHQAVHTADRPHCC
PDCGQAFRLRADFQRHRRGGGCVEPSGDGPRRESSEAPATVGPEEAEAEPEGPEAGEVER
EPETEAGGEAREEATAAAEVPTPGSKEEPEQDRRFVELGNGLGEGEGPSSHPLGFHFPVH
PKSWLHPDGFPILGLPDFGERLPGDGRPLPGPMGGPLSLVEGAGLACDPFGAGGAGGGGS
GGLRAFGPAVGGLLAEPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHRCA
DCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVCGA
GFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGFGH
SSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRSVL
VTHQRTHTGERPYACANCGRRFSQSSHLLTHMKTHRGTAGAPGQAAAPAPASKVQAPAKG
PLDVGAITGSGERGSTLLEFAGGTSFSSEHQAAFEGPSGAYEESVL
Download sequence
Identical sequences XP_012614295.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]