SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012620494.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012620494.1.48125
Domain Number 1 Region: 245-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-29
Family Laminin G-like module 0.088
Further Details:      
 
Domain Number 2 Region: 1524-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000584
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 689-765,798-816
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000616
Family Zinc protease 0.079
Further Details:      
 
Domain Number 4 Region: 1468-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000514
Family Complement control module/SCR domain 0.007
Further Details:      
 
Domain Number 5 Region: 1590-1647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number 6 Region: 537-617,720-775
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000198
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012620494.1.48125
Sequence length 1767
Comment pappalysin-2 isoform X2 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MTRLRVLRISLVILAGWACSTANSELGWTRKKSLAQRGHLNQVLLEGEHCWLGARARRPR
AAPQHHLFGVYPSRPGDYLRPYPVGEQGIRPAGRSEPDTGGKAVSLVPQDWMGNTAGARS
GAEPPVAPWLGDGPMGQSEPLGDDDTYVGNQRSKESLGETGTRKSTATAATITTAFSSLK
ELKAETQGKDRPKSGHRRPAVKRQAEDAWGGAGGSPPRSQPRPERPPKHGVRDSPLEDST
QNGGGDPSWDAGTSDSQGGLPVLYFSGRQERLRLRPEVLAETPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGTDKGRRDARFFFSLRTDRMKKATVVVSHRRYQ
PGVWTHVAATYDGRRMALYVDGTQVASSPDQSGPLNSPFMASCRSLLLGGDSSERGHHFR
GHVGTLAVWSAALPQGHLQHSPQRADGAEQLSALVLAASFEPLEEQWAPFREGTFPRLEV
LQGSGPEPEVLSPLQPPPCGQTACDNVELISQYNGHWPLRGEKVLRYQVVNVCDDEGRDP
TVSEEQVRRQHAALNEAFARYNISWRLSVRRVHNSTLRRRVVLVNCEPGKVGNDHCDPEC
EHPLTGYDGGDCRLQARCYSWNRRDGVCHAECNNMLNDFDDGDCCDPAVADVRKTCFDPD
SPRRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAISHLGGVVLNPA
YYGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETAPSMETGDLCADTAPTPKS
KLCGDPEPTNDTCGFAHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSES
RKPTPIPIPPMVIGQTRRSLTIHWLPPISGVVYDRALSSVCGACTEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPTEGCSLELLFQHP
VRADTLTLWVTYLSMDSSQALFDTEILLEHQESVHLGPLDTFCDTPLTIKLHVDGKVSGV
KVYTFDERMEIDAALLTSRPRSALCAGCRPVGYRVLREPPFPSGAAVAVTHPRRRFTDEE
VTPGQMYRYQVQVEAGTELGEASPPLNHIHGAPYCGDGKVAGSLGEECDDGDLLSGDGCS
RACELEEGFKCVGEPSLCYLYEGDGVCEPFERDTSIVDCGLHTPKGLLDLWATQAYSSNE
DKRKCPVSLVTGEPHSMVCTPYHPDLPRHHPLTGWFPCVTSGNRAQEEESEQPEGGLQKE
DEVWLKVCFNRPGVASAILIFLTTDGLVPGKHQKPTVTLHMTDVSGKNHSLGTYELSCQQ
NPLIINVTHHPNILFHPTTSVLLKFSSPLVGISAVALRTPSHISPSAPDSCIPEHTRENH
QEHSCVHRPCGEQGSCVPLLLDHADVANCTSSGPGHMKCAITCQRGCALQTSSGQFLRPV
QKEILLTCSSGHWDRDVSCMPLDCGVPDPSLVNHATFSCSEGTGFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPDVYCKLECGVPPIIPNADLLLPHCLQGSHDVGTVCRYECKPGY
YAVESAESEVRNKFLKIQCLEGGVWEQGSCTPVVCEPPSPVFEGMYECTNGFNLDSQCVL
NCNKESEKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNLVEYKCEQGYGIGAVCSPS
CIIPPSDPVTLPENTTVDTLEHWMKPVKVQPFQADGWCDTINNRAYCHYDGGDCCSSTLS
SKKVIPFAADCDLDECTCRDPTAEENQ
Download sequence
Identical sequences XP_012620494.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]