SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012622838.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012622838.1.48125
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 263-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000306
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012622838.1.48125
Sequence length 465
Comment sushi repeat-containing protein SRPX2 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MASQVTQRGALSLLFFLTPAVTATWYAGSGYHPDESYNEVYAEEVPQAPALDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQM
RCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGQWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSQFPEGEHVIR
YTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGAVCEYHCDGGYERQG
TPSRVCQSSRQWSGSSPICAPMKINVNVNSAAGLLDQFYEKRRLLIISAPDASNRYYKMQ
ISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSADIIEELRQFQRLTRSYFNMVL
VDKQGIDRERYMQPVTPEEIFTFIDDYLLSDQELTQRREQRDLCE
Download sequence
Identical sequences ENSMICP00000016314 ENSMICP00000016314 XP_012622835.1.48125 XP_012622836.1.48125 XP_012622838.1.48125 XP_012622839.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]