SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012627081.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012627081.1.48125
Domain Number 1 Region: 45-333,518-581
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-88
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 340-522
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.44e-58
Family GMC oxidoreductases 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012627081.1.48125
Sequence length 601
Comment choline dehydrogenase, mitochondrial [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MWCALRGWRQGLLGLHGALARGALGQRQLPGLWARALASMGPQSGDEYSYVVVGAGSAGC
VLARRLTEDPSEHVLLLEAGPRDLYAGSKRLLWKIHMPAALVANLCDNRYNWCYHTEPQP
GLDGRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHRQGAEGWDYAHCLPYFRKAQGH
ELGASRYRGGDGPLRVSRGKTNHPLHQAFLEAAQQAGYPLTEDMNGFQQEGFGWMDMTIH
EGKRWSTACAYLHPALSRPNLRAEARTLVSRVLFEGTRAVGVEYVKNGRSHRAYASKEVI
LSGGAINSPQLLMLSGVGNADDLKKLGIPVVCHLPGVGQNLQDHLEVYVQQACTRPITLH
SAQKPLRKACIGLEWLWRFTGDGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRV
PTQEDAYQVHVGTMRGTSVGWLKLRSANPQDHPVIQPNYLSTEADVEDFRRCVKLTREIF
AQEALAPFRGKELQPGSHVQSDEEIDAFVRAKADSAYHPSCTCKMGQPSDPAAVVDPQTR
VLGVESLRVVDASVMPSVVSGNLNAPTVMLAEKAADIIKGRPALWDEDVPVYKPRTLDTQ
R
Download sequence
Identical sequences XP_012627081.1.48125 XP_012627082.1.48125 ENSMICP00000015949 ENSMICP00000015949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]