SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012633553.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012633553.1.48125
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.94e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 3.97e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012633553.1.48125
Sequence length 551
Comment transcription factor p65 isoform X1 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MDDLFPLIFPSEPAQVSGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDSSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSTTSIPKPAPQPYPFTSSLSTINF
DEFSPMVFPSGQIPSQASALAPAPTQVLSHTPAPTSAMASALAQAPAPVQVLAPGPLQAV
APPAPKPTQAGEGTLTEALLQLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GVSMAPHTAEPMLMEYPESITRLVTGSQRPPDPAPNPLGASGIPNGLLSGDEDFSSIVDM
DFSALLSQISS
Download sequence
Identical sequences XP_012633553.1.48125 ENSMICP00000008076 ENSMICP00000008076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]