SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012639310.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012639310.1.48125
Domain Number 1 Region: 502-722
Classification Level Classification E-value
Superfamily Bet v1-like 1.72e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 103-248
Classification Level Classification E-value
Superfamily PH domain-like 9.76e-27
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012639310.1.48125
Sequence length 731
Comment collagen type IV alpha-3-binding protein isoform X2 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MQHSGVLCPPSPFSAPPTFLPVGTRENRRLASRGLSSGGGAGRNAGVTATTAAAADGWKG
RLPSPLVLLPRSARCQARRRRGGRTSSLLLLPPARERALFASPSPDSSPRGLGASSGTAQ
GAGAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVL
KNDALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQ
WIDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETF
RDILCRQVDTLQKFFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKL
FPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKESEKRRRA
EEACESIMLELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQNEKVRL
HRPTSLPSGDALTSVGPHSFFQKVEEMVQNHMNYSLQDVGGDANWQLVVEEGEMKVYRRE
VEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQ
THKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAM
ICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYV
QEKTAGKPILF
Download sequence
Identical sequences XP_012639310.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]