SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012640761.2.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012640761.2.48125
Domain Number 1 Region: 72-568
Classification Level Classification E-value
Superfamily Sema domain 2.62e-99
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1432-1557,1723-1880
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 1000-1090
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000165
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.082
Further Details:      
 
Domain Number 4 Region: 910-991
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000471
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 1087-1168
Classification Level Classification E-value
Superfamily E set domains 0.0000000000178
Family E-set domains of sugar-utilizing enzymes 0.069
Further Details:      
 
Domain Number 6 Region: 571-623
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000114
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012640761.2.48125
Sequence length 1947
Comment plexin-D1 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MHSPRRAARARPDGSSRRGGAPRSARPPRQPLPPRPPFRTPPRPPVPPRGRRPLPLLLLL
LGAARVGALEVQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPV
ADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQDLVVVCGSIYQGFCQLRRRGNISA
VAVRFPPAAPPAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGARGSRLLVGATYTGYGS
AYFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLG
FVRAFLHPAAPPPGAPSYAYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESY
IQLGLQCAGGAGRGDLYSRLVSVFPARELLFAVFERPQVAPGGRAAPAALCAFRFADVRA
AIRAARTACFVEPAPDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQ
PLKAAPVFRALGLTSVAVAVANNYTAVFLGTVSGRLLKINLDESMRVVSRRVVTVAYGEP
VHHVMQFDPADPGYLYLMTSHQMARVKVAACSAYSTCGDCVGAADAYCGWCALETRCTLR
RDCANSSQQHFWTSASAGPGRCPSMTVLPAEIDVRQEYPGMILQISGSLPSLSGMEMACD
YGNNIRTVARVPGPAFGHQIAYCNLLPRDRFPPFPPHQDHVTVEMSLRVNGQNIVRANFT
IYDCSRVGQVYPHTACTSCLSAQWPCFWCTQQHTCVSNRSRCDASPTPTSPRDCPRTLPA
PLAPVSTGGSQDILVPLANAAHFQGTALECSFGLEDTFEAVWVNESAVRCNQVVLHATQK
SQVFPLSLQLKGWPARFLDSPDPMTVEVYNCAMGSPDCSQCLGREDLGHLCVWSEGCRLR
GPLQPQPGPCPAPEIRAIEPLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLA
GRYTVSEEIVCATGPAPGPFSDVVTVNASKDGRSRERFSYVLPLVHSLEPAMGPKAGGTR
ITILGSDLHVGSELQVLVNDTEPCTELLRTDSSITCTMPGGALPAAVPVCVRFEHRGCVH
GNLTFWYMQNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAAHHIGREPTLCKVLN
STLITCPSPGALSNASVPVDFFINGRAYADEVAAAEELLAPEEAQRGSGFRLEYLPDPRF
STAKREKWIKHHPGEPLTLVIHKEQDGLGLQTHEYHVKIGQVACDIQIVSDRVIHCSVNE
SLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSR
RAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRT
FFPKCSSLYEERYVLPTQTLNSQGGSPVQETHPLLGEWKIPESRRPNMEEGISLFSSLLN
NKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKN
PKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLRAIKQQVNKGSIDAITGKAR
YTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYS
QWPRVEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKK
DNTLSRVKDLDTEKYFHLVLPTDELAEPRKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFL
DDLFKAILTIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKN
PQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKTVQRY
YKQIQDMAPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMTALEANPTA
RRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_012640761.2.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]