SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012645962.2.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012645962.2.48125
Domain Number 1 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 274-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-21
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 14-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-20
Family KRAB domain (Kruppel-associated box) 0.00076
Further Details:      
 
Domain Number 5 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 358-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.17e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 95-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.15e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000004
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 404-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000192
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 320-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000215
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 236-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000223
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012645962.2.48125
Sequence length 598
Comment zinc finger protein 709-like isoform X1 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MARTPGHPGSRETDLVSFEDVAVNFTLEEWALLDHSQRVLYRDVMWETFRNLQSIGKKQK
DQSIEDQYKKQGRNLRSHMVEKLDDSKEGSQCEQSFSQIPNLSLNKKTHTEVKPYKCSVC
GKLFICSSSLNRHIISHSRHKPYKCREYGEKPYKCKECGKGFSYLQSFKKHKRTHSAEIS
YKCKDCGKAFSCRYSLQIHGRTHVGGKPYECKKCGKAFRYLQSAQVHEKSHSGEKPYKCK
ECGKTFSYRHSVRKHERNHTSQKYYECKQCGKTYMSSLGFRAHERTHTGEKPYECKKCGK
AFMYHYSAQRHEKTHTGEKPYKCKECGKAFSYHHTAQKHERNHTDQKRYECEQCGKTYMT
PLGFRAHVSTHTGEKLYECKKCGKVFKYSQSMKTHERTHTGDKPYKCKECGEAFSCRYYA
QKHERTHTAEKEYECKTCGKTYISPLGFRTHERTHTGEKPYKCKECGKAFMYLTSVRIHM
ISHTGDGPYKCKECGKAFSCCSSFQKHERTHTGEKPYECKQCGKAFSHSSYIHMHERIHT
GEKPYECRECRKSFSFLTAFQVHMRMHNRNEPYKCQECGKTFRWRASLQKHARRVHTE
Download sequence
Identical sequences XP_012645962.2.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]