SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012648474.1.55366 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012648474.1.55366
Domain Number 1 Region: 421-468
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000243
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 244-338
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.000000163
Family Cdc48 domain 2-like 0.0043
Further Details:      
 
Weak hits

Sequence:  XP_012648474.1.55366
Domain Number - Region: 200-241
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0752
Family Cdc48 domain 2-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012648474.1.55366
Sequence length 470
Comment RING zinc finger protein, putative [Babesia microti strain RI]; AA=GCF_000691945.2; RF=representative genome; TAX=1133968; STAX=5868; NAME=Babesia microti strain RI; strain=RI; AL=Chromosome; RT=Major
Sequence
MLEIYANNGPFVLKRLHIAVNQKSCDEEQLFARLSEYNAKQMVINEGLVIYPVADCQEIS
YTVLKCEPNCGILDNETLVFVDRCVKSLCRIQLLWVVPDDYFDKLMKTLFLMNDSSNITY
IKSDYVTKLKNQNTVSGEGPFHISETMSINSKHEHRRTVSLNSNFDQPISILDQIDTPKS
LINSIYRAKLEPFLRRNGAKIYFPGQIFYAGDLEFLVYAIYPPDKPGHITRDTEIYVSLD
PWGEYQSVTIAPIRDTLPKIYDYDLHEDYLYPALNNKFKEAFRYGDSFNYLGVDFKITAT
YPYTSEFGCMRIGPNTQVTLGDPIDPTLADIIPSEDWNRIKMLSPRQQQIALHIAATQLD
ESAIQRITRTHSGQPKASYALINRLSASVERYKSPECGYDIFTKYGGSNLGYMFAEVVPD
TKNICTICCQRFKNFDKFITLQCGHMFHWCCVRAWIRENLTCPNCRSLCG
Download sequence
Identical sequences I7IQK7
XP_012648474.1.55366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]