SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012656617.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012656617.1.62490
Domain Number 1 Region: 1-761
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-289
Family Motor proteins 1.72e-16
Further Details:      
 
Domain Number 2 Region: 762-887
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.8e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 882-998
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.83e-20
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1168-1275
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.02e-18
Family Myosin rod fragments 0.0024
Further Details:      
 
Domain Number 5 Region: 986-1077
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000144
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1440-1553
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000174
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 7 Region: 1272-1376
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000115
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number 8 Region: 1685-1786
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000436
Family Regulator of G-protein signaling, RGS 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012656617.1.62490
Sequence length 1886
Comment PREDICTED: myosin-9 isoform X2 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEI
VDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHV
ASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANI
ETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQ
DKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKV
SHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRIN
KALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQR
EGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGTHP
KFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKD
VDRIIGLDQVAGMTETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIP
NHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFM
DGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYL
ARKAFAKRQQQLTAMRVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEEL
VKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELE
EICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLK
KLEEDQIIIEDQNCKLAKEKKLLEDRIAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEE
RLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEE
EAAQKNMALKKIRELESQISELQEDLESERAARNKAEKQKRDLGEELEALKTELEDTLDS
TAAQQELRSKREQEVNILKKTLEEEAKTHDAQIQEMRQKHSQAVEELAEQLEQAKRVKGN
LEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADK
VTKLQVELDSVTGLLSQSDSKSSKLSKDFSTLESQLQDTQELLQEETRQKLSLSTKLKQM
EDEKNSFKEQLEEEEEAKHNLEKQISTLHAQVADMKKKMEDGVGCLETAEEAKRKLQKDL
EGLSQRHEEKVAAFDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEK
TISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKD
DVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQ
GRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAVAARKKMEMDLKDLEAHIDTANKNRE
EAIKQLRKLQAQMKDCMRELDETRTSREEILAQAKENEKKLKSMEAEMMQLQEDLAAAER
AKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKK
ANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEA
KIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVEDERRNAEQYKDQADKASTRLKQ
LKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRM
ARKGTGDCSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences XP_012656617.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]